DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and LOC108182318

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_017209942.1 Gene:LOC108182318 / 108182318 -ID:- Length:330 Species:Danio rerio


Alignment Length:239 Identity:103/239 - (43%)
Similarity:135/239 - (56%) Gaps:0/239 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
            |:.||.|.|:|.|...||.|:..|..||.:.|.:|||....|....:||:.||..||:.|:.||:
Zfish    64 PFTCTQCGKSFSQSSHLNDHIMIHTGEKPFTCTQCGKSFIRLSLLNQHMMIHTGEKPYTCTQCGK 128

  Fly   369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLR 433
            .:|.||.|..|...|..:||:.|.||.:.::....|..|...||||:|:.|..|.|::..||||.
Zfish   129 SFRQTSYLNEHMMIHTGEKPFTCTQCWKSFSRSSDLNLHMRIHTGEKPFTCTQCGKSFSCSSSLN 193

  Fly   434 QHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGE 498
            :|...|||:|.|||..||...||.|...||||:|:|.|:..|..||..|:.:||||.|:|:|:||
Zfish   194 KHMRIHTGEKPFTCTQCGKSFSQSSDLNKHMMIHTGEKSFTCTQCGKTFSRSSNLNQHMRIHTGE 258

  Fly   499 KPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINPPS 542
            |||.|..|.|:|.....|..|||.|..|...|.|...:|...||
Zfish   259 KPFTCTKCGKSFNCSSHLNRHMRNHTGEKLFTCTQCGKSFRQPS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 60/146 (41%)
C2H2 Zn finger 307..327 CDD:275368 9/19 (47%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 63/135 (47%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
C2H2 Zn finger 447..467 CDD:275368 10/19 (53%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
zf-H2C2_2 487..510 CDD:290200 14/22 (64%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
LOC108182318XP_017209942.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.