DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF460

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_006626.3 Gene:ZNF460 / 10794 HGNCID:21628 Length:562 Species:Homo sapiens


Alignment Length:400 Identity:126/400 - (31%)
Similarity:180/400 - (45%) Gaps:56/400 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LNEEQENVANLDEELAEEDRRIFAMTVDEEEEFLTEEVDQDDELSEEEHQLAQSGDQQEE--HIT 197
            |.||    .:|.|:||:...|.         .:|.:.:|||.....:|:.|....|.|.|  |..
Human    70 LPEE----VSLQEQLAQGVPRY---------SYLGQAMDQDGPSEMQEYFLRPGTDPQSEKLHGK 121

  Fly   198 MESVHE-FQPAE-VEYVTIKNEF--ETIVTEEDEFEVMNDSGAHDAILDCQMIVIPAEGAIDEVI 258
            |...|| ...|: :..:.|:|:.  |..:...|.:..:.||..|:                    
Human   122 MSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHE-------------------- 166

  Fly   259 GEETLELEGDGREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQH 323
            ||.:.:.|....|...|.:.|.:..                 ...||.|..|.|||.:...|.||
Human   167 GENSYKFEEMFNENCFLVQHEQILP-----------------RVKPYDCPECGKAFGKSKHLLQH 214

  Fly   324 MRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKP 388
            ...|..||.|:|.||||......:...|..||...||..||.|||.:...|.|..|:|.|:.:||
Human   215 HIIHTGEKPYKCLECGKDFNRRSHLTRHQRTHNGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKP 279

  Fly   389 YNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVG 453
            :.|::||:.:....:...|..:|..::|:||..|.|.:|:|::|.||.|.|||::.|.|..||..
Human   280 FVCNECGKAFTYRSNFVLHNKSHNEKKPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKA 344

  Fly   454 LSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLAS 518
            .:.:|..|:|..:|:|.|...|..||.|||..|....|.|.|:|||||:|:.|.|||..:|.|..
Human   345 FNCRSHLKQHERIHTGEKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECKECGKAFSIRKDLIR 409

  Fly   519 HMRVHNKESP 528
            |..:|..|.|
Human   410 HFNIHTGEKP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 57/153 (37%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
COG5048 <387..523 CDD:227381 54/135 (40%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
zf-H2C2_2 403..426 CDD:290200 7/22 (32%)
C2H2 Zn finger 419..439 CDD:275368 9/19 (47%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 9/19 (47%)
zf-H2C2_2 487..510 CDD:290200 11/22 (50%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF460NP_006626.3 KRAB 12..53 CDD:307490
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
COG5048 222..552 CDD:227381 78/197 (40%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
C2H2 Zn finger 254..274 CDD:275368 9/19 (47%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
C2H2 Zn finger 310..330 CDD:275368 9/19 (47%)
C2H2 Zn finger 338..358 CDD:275368 6/19 (32%)
C2H2 Zn finger 366..386 CDD:275368 9/19 (47%)
C2H2 Zn finger 394..414 CDD:275368 8/19 (42%)
C2H2 Zn finger 422..442 CDD:275368
C2H2 Zn finger 450..470 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.