Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017454117.1 | Gene: | LOC102556092 / 102556092 | RGDID: | 7677226 | Length: | 261 | Species: | Rattus norvegicus |
Alignment Length: | 240 | Identity: | 97/240 - (40%) |
---|---|---|---|
Similarity: | 135/240 - (56%) | Gaps: | 6/240 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 287 FLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEH 351
Fly 352 MLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERP 416
Fly 417 YACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHA 481
Fly 482 FTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKE 526 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 57/153 (37%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <387..523 | CDD:227381 | 62/135 (46%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 13/22 (59%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 8/19 (42%) | ||
LOC102556092 | XP_017454117.1 | C2H2 Zn finger | 5..25 | CDD:275368 | 1/5 (20%) |
C2H2 Zn finger | 33..53 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 61..81 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 74..97 | CDD:404364 | 8/22 (36%) | ||
C2H2 Zn finger | 89..109 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <94..256 | CDD:227381 | 71/159 (45%) | ||
C2H2 Zn finger | 117..137 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 145..165 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 173..193 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 201..221 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 229..249 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24384 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |