Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038945844.1 | Gene: | LOC102548389 / 102548389 | RGDID: | 7541342 | Length: | 524 | Species: | Rattus norvegicus |
Alignment Length: | 225 | Identity: | 96/225 - (42%) |
---|---|---|---|
Similarity: | 131/225 - (58%) | Gaps: | 0/225 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
Fly 369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLR 433
Fly 434 QHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGE 498
Fly 499 KPFKCEVCVKAFPTKKRLASHMRVHNKESP 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 64/146 (44%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 8/19 (42%) | ||
COG5048 | <387..523 | CDD:227381 | 59/135 (44%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 8/19 (42%) | ||
LOC102548389 | XP_038945844.1 | KRAB | 61..101 | CDD:396083 | |
C2H2 Zn finger | 137..154 | CDD:275368 | |||
COG5048 | 158..519 | CDD:227381 | 93/219 (42%) | ||
C2H2 Zn finger | 162..182 | CDD:275368 | |||
C2H2 Zn finger | 190..210 | CDD:275368 | |||
C2H2 Zn finger | 218..238 | CDD:275368 | |||
C2H2 Zn finger | 246..266 | CDD:275368 | |||
C2H2 Zn finger | 274..294 | CDD:275368 | |||
C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 414..434 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 442..462 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 470..490 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |