DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and znf148

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_031748753.1 Gene:znf148 / 100487127 XenbaseID:XB-GENE-996852 Length:741 Species:Xenopus tropicalis


Alignment Length:187 Identity:56/187 - (29%)
Similarity:81/187 - (43%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICG 451
            |.:.|:.|...:....||:||...||||:|:.|..|:..:.....|::|:..|||:|.|.|:.||
 Frog   123 KCHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCEMRFIQKYLLQRHEKIHTGEKPFHCDECG 187

  Fly   452 VGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRL 516
            :...|    |.||                        ..|.|.||||||::||.|::.|....|:
 Frog   188 MRFIQ----KYHM------------------------ERHKRTHSGEKPYQCEYCLQYFSRTDRV 224

  Fly   517 ASHMRV--HNKESPVTATVAVQSINPPSRQAGAEGATGGG--ATGGSPTGGGATGGS 569
            ..|.|:  .|:|                |:.| :||..||  :..|.||.....||:
 Frog   225 LKHKRMCHENRE----------------RKPG-KGAGKGGLLSPEGDPTLSPKDGGA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 22/63 (35%)
C2H2 Zn finger 307..327 CDD:275368
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368
COG5048 <387..523 CDD:227381 43/137 (31%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 419..439 CDD:275368 4/19 (21%)
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
C2H2 Zn finger 475..495 CDD:275368 2/19 (11%)
zf-H2C2_2 487..510 CDD:290200 11/22 (50%)
C2H2 Zn finger 503..523 CDD:275368 7/21 (33%)
znf148XP_031748753.1 zf-C2H2 125..147 CDD:395048 6/21 (29%)
C2H2 Zn finger 127..147 CDD:275368 6/19 (32%)
zf-H2C2_2 139..164 CDD:404364 11/24 (46%)
C2H2 Zn finger 155..175 CDD:275368 4/19 (21%)
zf-H2C2_2 168..192 CDD:404364 10/23 (43%)
C2H2 Zn finger 183..203 CDD:275368 9/47 (19%)
zf-H2C2_2 195..220 CDD:404364 14/48 (29%)
C2H2 Zn finger 211..229 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.