DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF316

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001265488.1 Gene:ZNF316 / 100131017 HGNCID:13843 Length:1004 Species:Homo sapiens


Alignment Length:297 Identity:102/297 - (34%)
Similarity:139/297 - (46%) Gaps:20/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DSAPPT-AGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHT 356
            :.||.. |.|..|::|:.|.|.|.::..|.:|.|.|..|:.:.|.:|||...:..:...|..|||
Human   678 EPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHRCADCGKSFVYGSHLARHRRTHT 742

  Fly   357 NVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDL 421
            ..:|..|..||..:...|.||.|.|.|..:||:.|..||.|::...||..|...|||||||||..
Human   743 GERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVCGAGFSRRAHLTAHGRAHTGERPYACGE 807

  Fly   422 CDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTS 486
            |.:.:..|::|.:|:.:|..:|...|..||.|....|.:|:|...|:|.|..:|..||..|...|
Human   808 CGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCGRGFAQRS 872

  Fly   487 NLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINPPSR-------Q 544
            ||..|.|.|:||:||.|..|.|.|..:..|.:|.|.|..|.|.......:..:..|.       .
Human   873 NLAKHRRGHTGERPFPCPECGKRFSQRSVLVTHQRTHTGERPYACANCGRRFSQSSHLLTHMKTH 937

  Fly   545 AGAEGATGGG------------ATGGSPTGGGATGGS 569
            .||..|.|.|            |.|.|..|.|..|.:
Human   938 RGATAAPGSGSAPAPAPKPEAAAKGPSSAGPGERGSA 974

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 55/154 (36%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 55/135 (41%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 419..439 CDD:275368 5/19 (26%)
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
C2H2 Zn finger 475..495 CDD:275368 9/19 (47%)
zf-H2C2_2 487..510 CDD:290200 12/22 (55%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
ZNF316NP_001265488.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..148
KRAB 158..218 CDD:214630
COG5048 <345..503 CDD:227381
C2H2 Zn finger 347..367 CDD:275368
C2H2 Zn finger 375..395 CDD:275368
C2H2 Zn finger 403..423 CDD:275368
C2H2 Zn finger 431..451 CDD:275368
C2H2 Zn finger 459..479 CDD:275368
C2H2 Zn finger 487..505 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..574
C2H2 Zn finger 693..713 CDD:275368 7/19 (37%)
zf-H2C2_2 705..730 CDD:316026 9/24 (38%)
C2H2 Zn finger 721..741 CDD:275368 5/19 (26%)
COG5048 <746..933 CDD:227381 69/186 (37%)
C2H2 Zn finger 749..769 CDD:275368 8/19 (42%)
C2H2 Zn finger 777..797 CDD:275368 7/19 (37%)
C2H2 Zn finger 805..825 CDD:275368 5/19 (26%)
C2H2 Zn finger 833..853 CDD:275368 7/19 (37%)
C2H2 Zn finger 861..881 CDD:275368 9/19 (47%)
C2H2 Zn finger 889..909 CDD:275368 7/19 (37%)
C2H2 Zn finger 917..937 CDD:275368 1/19 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 936..976 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.