Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103210.1 | Gene: | zgc:173619 / 100006880 | ZFINID: | ZDB-GENE-071004-58 | Length: | 217 | Species: | Danio rerio |
Alignment Length: | 253 | Identity: | 81/253 - (32%) |
---|---|---|---|
Similarity: | 120/253 - (47%) | Gaps: | 38/253 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 204 FQPAEVEYVTIKNEFETIVTEEDEFEVMNDSGAHDAILDCQMIVIPAEGAIDEVIGEETLELEGD 268
Fly 269 GREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQY 333
Fly 334 ECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGY 398
Fly 399 AAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQ 456 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 59/153 (39%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <387..523 | CDD:227381 | 32/70 (46%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 5/10 (50%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | |||
zf-H2C2_2 | 487..510 | CDD:290200 | |||
C2H2 Zn finger | 503..523 | CDD:275368 | |||
zgc:173619 | NP_001103210.1 | COG5048 | <64..217 | CDD:227381 | 61/152 (40%) |
zf-C2H2 | 66..88 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 68..88 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 80..105 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 96..116 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 108..133 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 124..144 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 139..159 | CDD:290200 | 9/19 (47%) | ||
C2H2 Zn finger | 152..172 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 167..189 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 192..217 | CDD:290200 | 11/24 (46%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |