DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and Rnf212

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_003751367.2 Gene:Rnf212 / 689721 RGDID:1588767 Length:307 Species:Rattus norvegicus


Alignment Length:241 Identity:50/241 - (20%)
Similarity:83/241 - (34%) Gaps:81/241 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSCCALF--CDKKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCR---RSVRGRQL 77
            |:.||.|   |  ..:|.:|.|.:|.||||:.|:......        ||..|.   ::|...:.
  Rat     4 WVFCNRC---FQPPHRKSSFSLTSCGHVFCDSCILKGKKN--------ECMICEVPCQTVLLSKH 57

  Fly    78 TNSMPNHFKQLFHPEPFTIGNDFVETFQRGNHRHFDKYKERKELEMDKLFKDIEVAKSVCQKRFL 142
            |||.                   |:||                      |.||:   .:|:|...
  Rat    58 TNSN-------------------VQTF----------------------FLDID---GLCKKYSQ 78

  Fly   143 E----AQMLRVERKKLM--QRSRYIKAEVANRKAEMHRMAQAYRSRSLTSQSSSSAQRSARGRPR 201
            |    ::.....|::|:  .|.:..:.|.:.||:.: ::.|....||....:.::.:.|...:|.
  Rat    79 EISQISEFQEKHRRRLVTFYREKISQLEESLRKSVL-QIKQLQSMRSSQQPAFNTIKNSVSTKPN 142

  Fly   202 G--------------RGTATQSSSRRRSTESAKRQQITSFIHPPNN 233
            |              .......:|..|..|:|......|.|.||.:
  Rat   143 GYIFLPPNSSLPDRIESMDIDLTSPARKPETAAGPSRISLISPPQD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 16/54 (30%)
Cut12 <112..170 CDD:288368 11/63 (17%)
Rnf212XP_003751367.2 RING_Ubox 4..50 CDD:418438 17/56 (30%)
RING-HC finger (C3HC4-type) 7..45 CDD:319361 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22663
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.