DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and Rnf212

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_006535394.1 Gene:Rnf212 / 671564 MGIID:3645767 Length:315 Species:Mus musculus


Alignment Length:167 Identity:36/167 - (21%)
Similarity:66/167 - (39%) Gaps:46/167 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSCCALFCD--KKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCR---RSVRGRQL 77
            |:.||.|   |..  :|.:|.|.:|.||:|..|:......        ||..|:   ::|...:.
Mouse     4 WVFCNRC---FQSPHRKSSFSLTSCGHVYCHSCLLKGTKN--------ECVICQAPCQTVLLSKH 57

  Fly    78 TNSMPNHFKQLFHPEPFTIGND-----------FVETFQRGNHRHFDKYKERKELEMDKLFKDIE 131
            |||         :.:.|.:|.|           .:..||..:.|....:.:.|..::::     .
Mouse    58 TNS---------NIQTFFLGIDGLCKKYSQETSQISEFQEKHRRRLVAFYQEKISQLEE-----S 108

  Fly   132 VAKSVCQKRFLEAQMLRVERKKLMQRSRYIKAEVANR 168
            :.|||.|.:  :.|.:|..::....:   ||..|:.:
Mouse   109 LRKSVLQIK--QLQSMRSSQQPAFNK---IKNSVSTK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 15/54 (28%)
Cut12 <112..170 CDD:288368 10/57 (18%)
Rnf212XP_006535394.1 RING_Ubox 4..50 CDD:388418 16/56 (29%)
comFA 6..>113 CDD:226583 27/131 (21%)
RING-HC finger (C3HC4-type) 7..45 CDD:319361 14/48 (29%)
PHA03247 <148..300 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22663
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.