DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and zhp-4

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_741682.1 Gene:zhp-4 / 3565475 WormBaseID:WBGene00012678 Length:283 Species:Caenorhabditis elegans


Alignment Length:254 Identity:58/254 - (22%)
Similarity:104/254 - (40%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IHCNSCCALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRS-VRGRQLTNSMP 82
            :||..|.. |..|:..|:|..|.|:||..|.::.  ..|.:.|: :|..|.:: :|..::...:|
 Worm     4 VHCFRCYK-FPSKQIEFYLTNCMHMFCIECERLC--HPPEEEPL-KCIQCSKTPIRIVKMGPELP 64

  Fly    83 NHFKQLFHP-----EPFTIGNDFVETFQRGNHRHFDKYKERKELEMDKL---FKDIEVAKSVCQK 139
            ...|.:|.|     ..:|.....|.|||.........:.|||....|:|   :.:.:..|...:|
 Worm    65 MTIKSMFTPISEEINQYTRDLTRVLTFQHRQRASLSTFLERKVAAFDRLRDAYSEEKTKKEHYKK 129

  Fly   140 RFLEA-QMLRVE-------RKKLMQ---------RSRYIKAEVANRKAEMHRMAQAY-------- 179
            :..|| .:|:.:       :|:|.:         ||..:|. .::|..|...|.:.:        
 Worm   130 QLEEAYHLLKSKEHEISKLKKQLAEQAPPPQTPPRSNSLKV-ASSRSLETPSMMRVFSDSMYETP 193

  Fly   180 ---RSRSLTSQSSSSAQRSARGR-PRGRGTATQSSSRRRSTESAKRQQITSFIHPPNNS 234
               :.|...:|:.:.|:..|..: |..:...|:.:|..:|...|..:  |...|||..|
 Worm   194 VQIQRRFTKAQAKAEAEAEAPAKSPGSKAQTTKCTSNYQSHPPASFE--TPIHHPPKTS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 16/49 (33%)
Cut12 <112..170 CDD:288368 16/77 (21%)
zhp-4NP_741682.1 zf-RING_5 5..51 CDD:405339 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.