DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and RNF212

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001124506.1 Gene:RNF212 / 285498 HGNCID:27729 Length:297 Species:Homo sapiens


Alignment Length:238 Identity:52/238 - (21%)
Similarity:87/238 - (36%) Gaps:75/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSCCALFCDKKHT--FFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNS 80
            |:.||.|   |.....|  |.|..|.||:|:.|:    |:...:    ||..|:...|...|:  
Human     4 WVFCNRC---FQPPHRTSCFSLTNCGHVYCDACL----GKGKKN----ECLICKAPCRTVLLS-- 55

  Fly    81 MPNHFKQLFHPEPFTIGNDFVETFQRGNHRHFDKYKERKELEMDKLFKDIEVAKSVCQKRFLE-A 144
                                         :|.|       .::...|..|:   |:|:|...| :
Human    56 -----------------------------KHTD-------ADIQAFFMSID---SLCKKYSRETS 81

  Fly   145 QMLRVE---RKKLM--QRSRYIKAEVANRKAEMHRMAQAYRSRSLTSQSSSSAQRSARGRPRGRG 204
            |:|..:   ||:|:  .|.:..:.|.:.||:.: ::.|....||....:.|:.:.|...:|.|..
Human    82 QILEFQEKHRKRLLAFYREKISRLEESLRKSVL-QIEQLQSMRSSQQTAFSTIKSSVSTKPHGCL 145

  Fly   205 TATQSSSRRR--------STESAKRQQIT------SFIHPPNN 233
            ....||:..|        |....::.:|.      |.|.||.:
Human   146 LPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 16/51 (31%)
Cut12 <112..170 CDD:288368 15/63 (24%)
RNF212NP_001124506.1 RING_Ubox 4..50 CDD:327409 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22663
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.