DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and R06C7.2

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_492044.2 Gene:R06C7.2 / 187640 WormBaseID:WBGene00011062 Length:233 Species:Caenorhabditis elegans


Alignment Length:69 Identity:14/69 - (20%)
Similarity:26/69 - (37%) Gaps:23/69 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIGND 99
            |||::.:....||...            |.|:|..:.           :.|:.||.|.|..:.|:
 Worm   125 FFLISENDELLERVFH------------FHCATFTKL-----------SDFQLLFFPTPMYVANE 166

  Fly   100 FVET 103
            :.::
 Worm   167 YAKS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 8/34 (24%)
Cut12 <112..170 CDD:288368
R06C7.2NP_492044.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.