powered by:
Protein Alignment vilya and R06C7.2
DIOPT Version :9
Sequence 1: | NP_570026.1 |
Gene: | vilya / 31264 |
FlyBaseID: | FBgn0283545 |
Length: | 237 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492044.2 |
Gene: | R06C7.2 / 187640 |
WormBaseID: | WBGene00011062 |
Length: | 233 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 14/69 - (20%) |
Similarity: | 26/69 - (37%) |
Gaps: | 23/69 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 FFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIGND 99
|||::.:....||... |.|:|..:. :.|:.||.|.|..:.|:
Worm 125 FFLISENDELLERVFH------------FHCATFTKL-----------SDFQLLFFPTPMYVANE 166
Fly 100 FVET 103
:.::
Worm 167 YAKS 170
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
vilya | NP_570026.1 |
zf-RING_5 |
20..70 |
CDD:291308 |
8/34 (24%) |
Cut12 |
<112..170 |
CDD:288368 |
|
R06C7.2 | NP_492044.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4739 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.