DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and zhp-3

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001250802.1 Gene:zhp-3 / 172644 WormBaseID:WBGene00006976 Length:389 Species:Caenorhabditis elegans


Alignment Length:253 Identity:58/253 - (22%)
Similarity:101/253 - (39%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSCCALFCDK-KHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSM 81
            ::|||.|   |..| ...||:.:|.|:||.:|.|         |.:..|..|:::||..:|..::
 Worm     3 FVHCNKC---FNRKPPDGFFISSCFHIFCTKCAK---------ADLAVCLICKKNVRLVRLDGNI 55

  Fly    82 PNHFKQLFHPEPFTIGNDFVE------TFQRGNHRHFDKY--KER-KELEMDKLFKDIEVAKSVC 137
            .:..| ::..:|..:..|.:.      .||:....|..||  ||: |:.:|:..|:         
 Worm    56 SSGIK-IYFADPIKMVADSLAKIQKKIDFQQSTRDHLVKYLTKEKEKKRQMEVYFR--------- 110

  Fly   138 QKRFLEAQMLRVERKKLMQRSRYIKAEVANRKAEMHRMAQAYRS--------RSLTSQSSS---- 190
                .:.|....:||||.:.:.:|:......:|......:|.|.        :|:|:..|:    
 Worm   111 ----TKGQEFDSQRKKLAEATAWIQMAEKKLQASEEERVKAEREIEECQAKLKSMTNLMSADTLG 171

  Fly   191 ---------SAQRSARGRPRGRGTATQSSSRRRSTESAKRQQITSFIHPPN----NSF 235
                     |...|....|    :..:||:  .||.:.....::|....||    |||
 Worm   172 MNSQTPFPFSLAESQETAP----SLVESSA--NSTFNMVSPLVSSPASSPNSINYNSF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 17/50 (34%)
Cut12 <112..170 CDD:288368 13/60 (22%)
zhp-3NP_001250802.1 RING-HC_RNF212_like 5..43 CDD:319474 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106595
Panther 1 1.100 - - LDO PTHR22663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.