DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and zhp-2

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001370064.1 Gene:zhp-2 / 172637 WormBaseID:WBGene00008387 Length:240 Species:Caenorhabditis elegans


Alignment Length:231 Identity:58/231 - (25%)
Similarity:97/231 - (41%) Gaps:47/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSCCALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSMP 82
            ||.||.|.  ....:...:|.||.||||:.|.|.:...        :|..|::.::..::..::.
 Worm     3 WIQCNHCG--IKPNQTKLYLTACGHVFCQNCTKAAFNS--------QCYLCKKPLKVDEINKNLR 57

  Fly    83 NHFKQLFHPEPFTIGNDFVE------TFQRGNHRHFDKYKERKELEMDKLFKDIEVAKSVCQKRF 141
            ....:|| .:|..:.:|.|.      .||            .|:.|:....|:.|..|..  :||
 Worm    58 PDLMELF-KDPRQLASDLVNELKQVVAFQ------------AKQREIYVKCKNAEAKKDT--ERF 107

  Fly   142 LEAQMLRVERKKLMQRSRYIKA------EVANRKAEMHR-MAQAYRSRSLTSQSSSSAQRSARGR 199
            .||:...||:.:.:::.:  ||      ::.|.|.|.:: ||:....|...||:.|..:|.:..|
 Worm   108 AEARSKHVEKTQEIEKRK--KAFLEDNVKLKNAKEEKNQLMARLKELREQPSQNLSVNKRRSNTR 170

  Fly   200 ---PRGR--GTATQSSSRRRSTESA--KRQQITSFI 228
               |..:  .|...|..|:.|.|.:  .|.|.||.|
 Worm   171 TEPPFSKISRTGPPSVMRKASHEFSLNLRDQSTSKI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 14/49 (29%)
Cut12 <112..170 CDD:288368 14/63 (22%)
zhp-2NP_001370064.1 zf-RING_5 6..45 CDD:405339 14/48 (29%)
RING-HC finger (C3HC4-type) 6..43 CDD:319361 13/46 (28%)
PRK00409 <76..>166 CDD:234750 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106595
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.