DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and zhp-1

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_491578.1 Gene:zhp-1 / 172186 WormBaseID:WBGene00018867 Length:220 Species:Caenorhabditis elegans


Alignment Length:235 Identity:56/235 - (23%)
Similarity:87/235 - (37%) Gaps:64/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSC-CALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSM 81
            :|.||.| |:   ..|..||:.||.|||||.|      ||...|..  |..|:...:..::..|:
 Worm     3 FIVCNGCGCS---PSKRQFFITACSHVFCETC------RTTPTADF--CHLCKIPTKTLKMDASL 56

  Fly    82 PNHFKQLFHPEPFTIGNDFVETFQRGNHRH------FDKYKERKELEMDKLFKDIEVAKSVCQKR 140
            |.:.|::|       |:  |.......|:.      |.|.::..:|:|       |..|||.:|.
 Worm    57 PKNVKKMF-------GD--VGVMSTDIHKRLARVIGFQKIQKSIQLKM-------ENKKSVMRKE 105

  Fly   141 FLEAQMLRVERK---KLMQRSRYIKAEVANRK---------AEMHRMAQAYRSRSLTSQSSSSAQ 193
                |..:||:|   ...|.|:....|..|||         .::..:..|...:..:|:.....:
 Worm   106 ----QTKKVEKKTEEMHCQLSKLTSFEENNRKKLEDIERENEKLRNLISALELKVASSRDIDDDE 166

  Fly   194 RSARGRPRGRGTATQSSS--------------RRRSTESA 219
            ...:|.|.....:...|.              |.||..|:
 Worm   167 FFMQGTPTSSNPSVAGSDVDNDELLDYDLLGLRNRSDSSS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 20/50 (40%)
Cut12 <112..170 CDD:288368 19/69 (28%)
zhp-1NP_491578.1 zf-RING_5 6..44 CDD:405339 19/48 (40%)
RING-HC finger (C3HC4-type) 6..43 CDD:319361 19/47 (40%)
PRK03918 85..>158 CDD:235175 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106595
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.