Sequence 1: | NP_570026.1 | Gene: | vilya / 31264 | FlyBaseID: | FBgn0283545 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491578.1 | Gene: | zhp-1 / 172186 | WormBaseID: | WBGene00018867 | Length: | 220 | Species: | Caenorhabditis elegans |
Alignment Length: | 235 | Identity: | 56/235 - (23%) |
---|---|---|---|
Similarity: | 87/235 - (37%) | Gaps: | 64/235 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 WIHCNSC-CALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSM 81
Fly 82 PNHFKQLFHPEPFTIGNDFVETFQRGNHRH------FDKYKERKELEMDKLFKDIEVAKSVCQKR 140
Fly 141 FLEAQMLRVERK---KLMQRSRYIKAEVANRK---------AEMHRMAQAYRSRSLTSQSSSSAQ 193
Fly 194 RSARGRPRGRGTATQSSS--------------RRRSTESA 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vilya | NP_570026.1 | zf-RING_5 | 20..70 | CDD:291308 | 20/50 (40%) |
Cut12 | <112..170 | CDD:288368 | 19/69 (28%) | ||
zhp-1 | NP_491578.1 | zf-RING_5 | 6..44 | CDD:405339 | 19/48 (40%) |
RING-HC finger (C3HC4-type) | 6..43 | CDD:319361 | 19/47 (40%) | ||
PRK03918 | 85..>158 | CDD:235175 | 19/83 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4739 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007154 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_106595 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.800 |