DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vilya and Rnf212b

DIOPT Version :9

Sequence 1:NP_570026.1 Gene:vilya / 31264 FlyBaseID:FBgn0283545 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001357828.1 Gene:Rnf212b / 102632837 MGIID:5589964 Length:297 Species:Mus musculus


Alignment Length:275 Identity:61/275 - (22%)
Similarity:95/275 - (34%) Gaps:79/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIHCNSCCALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSMP 82
            |.|||.|...  |..| ||:.:|.|:||::|:.:.           :|:.|....:...|::::.
Mouse     3 WFHCNQCFRK--DGAH-FFVTSCGHIFCKKCMTLE-----------KCAVCGNLCKHLALSDNLK 53

  Fly    83 NHFKQLFHPEPFTIGNDF-----VETFQRGNHRHFDK----YKERKELEMDKLFKDIEVAKSVCQ 138
            ...|:.|.....|....|     |..||:   :..|.    ||:|    :.||...::.|:.:..
Mouse    54 PQEKKFFKSPVETALQCFSHISQVWCFQK---KQTDLLIAFYKDR----ITKLEAAVKEAQEMAA 111

  Fly   139 KRFLEAQMLRVERKKLMQRSRYIKA-----------------------EVANRKAEMHRMAQAYR 180
            .:..|...||.|..:|.:....:|.                       .||.|.:..|......|
Mouse   112 SQNKELSALRKENGELKKILDILKGSPSCYYGSRLTTPRPVGITSPSQSVAPRPSSHHSSQVVSR 176

  Fly   181 SRSL-----TSQSSSSAQRSARG-----RPRGRGTATQSSSRRRS----TESAKRQQITSF---- 227
            |.|:     |.......::.:||     .|....|.|.|.:...|    ..||...|..||    
Mouse   177 SSSMESIPYTVAGMGHVEQGSRGLHVRSTPGDSYTETPSPASTHSLSYRPSSASSGQGVSFRPFF 241

  Fly   228 --------IHPPNNS 234
                    :..||||
Mouse   242 SGDSGHTRVLTPNNS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vilyaNP_570026.1 zf-RING_5 20..70 CDD:291308 15/49 (31%)
Cut12 <112..170 CDD:288368 16/84 (19%)
Rnf212bNP_001357828.1 RING-HC_RNF212B 5..40 CDD:319661 14/48 (29%)
RING-HC finger (C3HC4-type) 6..39 CDD:319661 13/46 (28%)
bZIP <93..124 CDD:389750 8/34 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..179 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..269 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106595
Panther 1 1.100 - - LDO PTHR22663
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.