DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and AT5G53360

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001330825.1 Gene:AT5G53360 / 835417 AraportID:AT5G53360 Length:233 Species:Arabidopsis thaliana


Alignment Length:128 Identity:27/128 - (21%)
Similarity:44/128 - (34%) Gaps:27/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 EPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRWQ 305
            :|......:.:|.:.......|.:.:.||....|......||.||.::|..| :.|   .:|...
plant     7 QPVNQECIIALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAG---SECAAV 68

  Fly   306 GREVQWKEHLEEQH----------DDRLFRSSSADLE---WNLGTRRKPLTGYYVFQAHDEMF 355
            |.......||.:.|          :.|..:|:..::|   |.|          .|||...:.|
plant    69 GDITFLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWML----------TVFQCFGQYF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 0/1 (0%)
Sina 248..442 CDD:281181 26/122 (21%)
AT5G53360NP_001330825.1 Sina 15..211 CDD:397316 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.