DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and AT5G37910

DIOPT Version :10

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_198607.1 Gene:AT5G37910 / 833770 AraportID:AT5G37910 Length:276 Species:Arabidopsis thaliana


Alignment Length:154 Identity:37/154 - (24%)
Similarity:60/154 - (38%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 EGPPTVSARHYEGLI----EELRCPGCAGAMKAPILLCKSGHSVCEQ-CTRILLMCPLCKEPFTN 246
            :|...|:.|....::    :.|.||.|..|:.:||..|.:||..|.. |.::...||.|..|..:
plant    15 DGGERVAKRQRSAIVLLDLDILDCPICCEALTSPIFQCDNGHLACGSCCPKLSNKCPACTLPVGH 79

  Fly   247 SRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKCFMGRVWGDCRWQGREVQW 311
            |||..:|::.......|.:...||...........||::|::....|    ....|.:.|.....
plant    80 SRSRAMESVLESILIPCPNVRFGCTKSFFYGKESAHEKECIFSQCSC----PSSVCDYTGSYKDL 140

  Fly   312 KEHLEEQHDDRLFRSSSADLEWNL 335
            ..|.:..|...:|        ||:
plant   141 YAHYKLTHSTNIF--------WNI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING_Ubox 206..250 CDD:473075 17/44 (39%)
Sina 248..442 CDD:460824 17/88 (19%)
AT5G37910NP_198607.1 RING-HC_SIAHs 36..73 CDD:438233 14/36 (39%)
Sina 81..>233 CDD:460824 17/88 (19%)

Return to query results.
Submit another query.