DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and AT4G27880

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_194517.1 Gene:AT4G27880 / 828901 AraportID:AT4G27880 Length:327 Species:Arabidopsis thaliana


Alignment Length:187 Identity:49/187 - (26%)
Similarity:72/187 - (38%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PSEEGPPTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQC-TRILLMCPLCKEPFTNS 247
            |:...|.|       .:.|.|.||.|..:|..||..|.:||::|..| .|:...||.|::...:.
plant    49 PTATAPAT-------SVYELLECPVCTYSMYPPIHQCHNGHTLCSTCKVRVHNRCPTCRQELGDI 106

  Fly   248 RSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRWQGREVQW 311
            |.|.:|.:.......|...:.||....|......||..|.::|..| :.|   .:|...|.....
plant   107 RCLALEKVAESLELPCKFYNLGCPEIFPYYSKLKHESLCNFRPYSCPYAG---SECGIVGDIPFL 168

  Fly   312 KEHLEEQH----------DDRLFRSSSADLE---WNLGTRRKPLTGYYVFQAHDEMF 355
            ..||.:.|          :.|..:|:..::|   |.|....  ..|.| |..|.|.|
plant   169 VAHLRDDHKVDMHAGSTFNHRYVKSNPREVENATWMLTVFH--CFGQY-FCLHFEAF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 15/38 (39%)
Sina 248..442 CDD:281181 29/122 (24%)
AT4G27880NP_194517.1 RING-HC_SIAHs 62..100 CDD:319485 15/37 (41%)
Sina 106..305 CDD:397316 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.