DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and AT3G13672

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001319542.1 Gene:AT3G13672 / 820573 AraportID:AT3G13672 Length:243 Species:Arabidopsis thaliana


Alignment Length:80 Identity:19/80 - (23%)
Similarity:34/80 - (42%) Gaps:20/80 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 LHFNRKYLRNTLNDATPAEDELRPLAADLRNGNGDDKLSQCSNSTSYTKKVSDSLRR-SFRALKA 600
            |:|...:||.|            |:........||::.:.   |.||:.:|..:.|: :::.:..
plant   141 LYFEAFHLRKT------------PMYMAFMQFMGDEEEAM---SFSYSLQVGGNGRKLTWQGVPR 190

  Fly   601 DIVELRPFSKKAVRD 615
            .|.:    |.|.|||
plant   191 SIRD----SHKTVRD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093
Sina 248..442 CDD:281181
AT3G13672NP_001319542.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.