DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and siah1

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_005159200.1 Gene:siah1 / 80955 ZFINID:ZDB-GENE-010319-31 Length:334 Species:Danio rerio


Alignment Length:246 Identity:69/246 - (28%)
Similarity:102/246 - (41%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DSSIIRQSFPEGVITPSKPEKSPATPSEEGP----PTVSARHYEGLIEELRCPGCAGAMKAPILL 219
            |..:.||:   ....|:...|.|  ||:..|    .|.|......|.|   ||.|...:..|||.
Zfish    50 DEEMSRQT---ATALPTGTSKCP--PSQRVPTLSGTTASNSDLASLFE---CPVCFDYVLPPILQ 106

  Fly   220 CKSGHSVCEQCTRILLMCPLCKEPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQ 284
            |:|||.||..|...|..||.|:.|..:.|:|.:|.:.....|.|.:||.||:|.:|......||:
Zfish   107 CQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKAEHEE 171

  Fly   285 QCMYKPMKC-FMGRVWGDCRWQGREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLG 336
            .|.::|..| ..|   ..|:|||.......||..||        :|.:|.::..:|    :|   
Zfish   172 LCEFRPYSCPCPG---ASCKWQGSLDAVMPHLLHQHKSITTLQGEDIVFLATDINLPGAVDW--- 230

  Fly   337 TRRKPLTGYYVFQAHDEMFNFYEIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
            ...:...|::.....::.    |.:|..:..|.:......|....||||.:
Zfish   231 VMMQSCFGFHFMLVLEKQ----EKYDGHQQFFAIVQLIGTRKQAENFAYRL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 38/153 (25%)
siah1XP_005159200.1 Sina 134..330 CDD:281181 38/154 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.