DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and cyhr1

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001070208.1 Gene:cyhr1 / 767773 ZFINID:ZDB-GENE-060929-720 Length:375 Species:Danio rerio


Alignment Length:259 Identity:61/259 - (23%)
Similarity:91/259 - (35%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GPADG---KGPASNG--ALSPDSSIIRQSFPEGVITPSKPEKSPATPSEEGPPTVSARHYEG--- 199
            ||..|   .||||.|  .:..:|.:.|    :|.:..:.|         :.||....|..||   
Zfish    19 GPVGGALDAGPASAGLAGIQEESGVRR----DGSVGEADP---------DAPPKKRVRLQEGEAG 70

  Fly   200 -----LIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILL----------MCPLCKEPFTNS-- 247
                 |...|.|..|....||.:..|.:||.:|..|...||          .||.|:...:.|  
Zfish    71 KLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKSLC 135

  Fly   248 -RSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHE-QQCMYKPMKCFMGRVWGDCRWQGREVQ 310
             |:|.||...::....|.:    |..:.|...|..|: ::|..:..:|...|:  .|.|||    
Zfish   136 CRNLAVEKAVSELPSECSY----CLKQFPRSGLDRHQTEECQDRVTQCKYKRI--GCPWQG---- 190

  Fly   311 WKEHLEEQHDDRLFRSSSADLEWNLGTRRKPLTGYY--VFQAHDEMFNFYEIHDRQRVLFTMTC 372
             ..|....|:......|...:|         |.|..  :.|:|......|      ..:|::.|
Zfish   191 -PFHELSAHEAECCHPSKTGME---------LMGILDEMDQSHRRELQLY------NSIFSLLC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 14/47 (30%)
Sina 248..442 CDD:281181 27/128 (21%)
cyhr1NP_001070208.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..65 7/41 (17%)
Sina 137..>198 CDD:302762 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.