DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and SIAH2

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_005058.3 Gene:SIAH2 / 6478 HGNCID:10858 Length:324 Species:Homo sapiens


Alignment Length:291 Identity:85/291 - (29%)
Similarity:119/291 - (40%) Gaps:47/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ATLPSPNVVTLRSPLS--PPPKPPMLGRTRSTGPADGKGPASNGALSPDSSIIRQSFPEGVITPS 175
            :|.||.|     .|.|  |||:|     ..:..||.....|:..|..|.||.:    |......|
Human     6 STGPSAN-----KPCSKQPPPQP-----QHTPSPAAPPAAATISAAGPGSSAV----PAAAAVIS 56

  Fly   176 KPEKSPATPSEEGPPTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLC 240
                .|......||  ||.:|:| |.....||.|...:..|||.|::||.||.||.:.|..||.|
Human    57 ----GPGGGGGAGP--VSPQHHE-LTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTC 114

  Fly   241 KEPFTNS-RSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCR 303
            :...|.| |:|.:|.:.:...|.|.:|:.||.:.:.....|.||..|.|:|..| ..|   ..|:
Human   115 RGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPG---ASCK 176

  Fly   304 WQGREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAHDEMFN 356
            |||.......||...|        :|.:|.::..:|    :|   ...:...|:: |....|...
Human   177 WQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDW---VMMQSCFGHH-FMLVLEKQE 237

  Fly   357 FYEIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
            .||.|.:   .|.:......|....||||.:
Human   238 KYEGHQQ---FFAIVLLIGTRKQAENFAYRL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 39/153 (25%)
SIAH2NP_005058.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 14/45 (31%)
RING-HC_SIAH2 78..115 CDD:319666 16/36 (44%)
Sina 122..318 CDD:397316 39/154 (25%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 130..322 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.