DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and SIAH1

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001006611.1 Gene:SIAH1 / 6477 HGNCID:10857 Length:313 Species:Homo sapiens


Alignment Length:231 Identity:65/231 - (28%)
Similarity:97/231 - (41%) Gaps:32/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PSKPEKSPATPSEEGP----PTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRIL 234
            |:...|.|  ||:..|    .|.|......|.|   ||.|...:..|||.|:|||.||..|...|
Human    41 PTGTSKCP--PSQRVPALTGTTASNNDLASLFE---CPVCFDYVLPPILQCQSGHLVCSNCRPKL 100

  Fly   235 LMCPLCKEPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRV 298
            ..||.|:.|..:.|:|.:|.:.....|.|.:||.||::.:|......||:.|.::|..| ..|  
Human   101 TCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPG-- 163

  Fly   299 WGDCRWQGREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAH 351
             ..|:|||.......||..||        :|.:|.::..:|    :|   ...:...|::.....
Human   164 -ASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDW---VMMQSCFGFHFMLVL 224

  Fly   352 DEMFNFYEIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
            ::.    |.:|..:..|.:......|....||||.:
Human   225 EKQ----EKYDGHQQFFAIVQLIGTRKQAENFAYRL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 37/153 (24%)
SIAH1NP_001006611.1 RING-HC_SIAH1 70..109 CDD:319665 18/41 (44%)
RING-HC finger (C3HC4-type) 72..106 CDD:319665 16/33 (48%)
Sina 113..309 CDD:367355 37/154 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.