DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and ZFTRAF1

DIOPT Version :10

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001317547.1 Gene:ZFTRAF1 / 50626 HGNCID:17806 Length:404 Species:Homo sapiens


Alignment Length:205 Identity:54/205 - (26%)
Similarity:76/205 - (37%) Gaps:37/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PPMLGRTRSTGPADGKGPASNGALS-------PDSSII---RQ-SFPEGVITPSKPEKSPATPSE 186
            |..:|.....||....|.|:..||.       ||.:.:   || ...|....|..|.|.....:|
Human    21 PAGVGVGVGAGPGAAAGQAAAAALGEAAGPGLPDEAGLAGARQLQLQEAAGDPDAPPKKRLRAAE 85

  Fly   187 EGPPTVSARHY-EGLIEE-----LRCPGCAGAMKAPILLCKSGHSVCEQCTRILL---------- 235
            ......:|... .|.:||     |.|..|....||.:..|.:||.:|..|...||          
Human    86 AAEAAAAAAAAGSGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQA 150

  Fly   236 MCPLCKEPFTNS---RSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHE-QQCMYKPMKCFMG 296
            .||.|:...:.|   |:|.||...::....||.    |..:.|..||..|: ::|..:..:|...
Human   151 TCPNCRCEISKSLCCRNLAVEKAVSELPSECGF----CLRQFPRSLLERHQKEECQDRVTQCKYK 211

  Fly   297 RVWGDCRWQG 306
            |:  .|.|.|
Human   212 RI--GCPWHG 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING_Ubox 206..250 CDD:473075 16/56 (29%)
Sina 248..442 CDD:460824 17/60 (28%)