DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and CG6688

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:165 Identity:35/165 - (21%)
Similarity:69/165 - (41%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 EGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLCKEPFTNSRSLTVEAL---CAKA 259
            |.::..:.||.|...:..|.:.|::||.:|..|......||:|::.:|..|:|..|.:   .|.|
  Fly   136 ESILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANA 200

  Fly   260 HFRCGHASGGCQ-----VRMPVV--------LLPWHEQQCMYKPMKCFMGRVWGDCRWQGREVQW 311
            ...|...:...|     :..|||        ...|.:::.:. |...|:.::...|.:.      
  Fly   201 FEMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVL-PTNKFLTKLLEGCAYS------ 258

  Fly   312 KEHLEEQHDDRLFRSSSADLEWN---LGTRRKPLT 343
            .::|...:...|.|:::.|:..:   :..|..|:|
  Fly   259 TDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 12/37 (32%)
Sina 248..442 CDD:281181 21/115 (18%)
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.