DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and siah2l

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_956721.2 Gene:siah2l / 378728 ZFINID:ZDB-GENE-030922-1 Length:330 Species:Danio rerio


Alignment Length:315 Identity:79/315 - (25%)
Similarity:128/315 - (40%) Gaps:44/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GRTRSTGPADGKGPASNGALSPDSSIIRQSFPEGVITPSKPEKSPATPSEEGP---PTVSARHYE 198
            |.|.::..|.....|:..|.:..:.:.......|.:    |..:.|.|....|   |.::|    
Zfish    28 GGTTASAAAAAAAAAAAAAAAAAAGVSGSVAGSGTV----PAAAVALPVAALPGQSPELTA---- 84

  Fly   199 GLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLCKEPFTNS-RSLTVEALCAKAHFR 262
             |.|   ||.|...:..|||.|::||.||.||.:.|..||.|:.|.|.| |:|.:|.:.:...|.
Zfish    85 -LFE---CPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGPLTPSIRNLAMEKVASTLPFP 145

  Fly   263 CGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRWQGREVQWKEHLEEQH------- 319
            |.::|.||.:.:.....|.||:.|.::|..| ..|   ..|:|||...:...||...|       
Zfish   146 CKYSSAGCLLSLHHSEKPEHEEVCEFRPYTCPCPG---ASCKWQGSLEEVMPHLMHAHKSITTLQ 207

  Fly   320 -DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAHDEMFNFYEIHDRQRVLFTMTCTSNRRDS 379
             :|.:|.::..:|    :|   ...:...|:: |....|....||.|.:   .|.:......|..
Zfish   208 GEDIVFLATDINLPGAVDW---VMMQSCFGHH-FMLVLEKQEKYEGHQQ---FFAIVLLIGTRKQ 265

  Fly   380 KYNFAYEVTVLLPDNEALSMTQKFPVHSEYD--KDILMEGTCVSIPLTELNRFLD 432
            ..||||.:.:   :.....:|.:....|.:|  ...:|...|:....:..:.|.|
Zfish   266 AENFAYRLEL---NGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTSIAHLFAD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 45/200 (23%)
siah2lNP_956721.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Sina 130..326 CDD:281181 45/201 (22%)
SBD 138..330 42/193 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.