DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and Siah1b

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001295314.1 Gene:Siah1b / 20438 MGIID:108063 Length:282 Species:Mus musculus


Alignment Length:225 Identity:61/225 - (27%)
Similarity:94/225 - (41%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SPATPSEEGP----PTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLC 240
            |...||:..|    .|.|......|.|   ||.|...:..|||.|:|||.||..|...|..||.|
Mouse    14 SKCPPSQRVPALTDTTASNNDLASLFE---CPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTC 75

  Fly   241 KEPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRW 304
            :.|..:.|:|.:|.:.....|.|.:::.||::.:|......||:.|.::|..| ..|   ..|:|
Mouse    76 RGPLGSIRNLAMEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPG---ASCKW 137

  Fly   305 QGREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAHDEMFNF 357
            ||.......||..||        :|.:|.::..:|    :|   ...:...|::.....::.   
Mouse   138 QGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDW---VMMQSCFGFHFMLVLEKQ--- 196

  Fly   358 YEIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
             |.:|..:..|.:......|....||||.:
Mouse   197 -EKYDGHQQFFAIVQLIGTRKQAENFAYRL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 35/153 (23%)
Siah1bNP_001295314.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 3/8 (38%)
Sina 82..278 CDD:281181 35/154 (23%)
SBD 90..282 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.