DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and Siah1a

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_006530847.3 Gene:Siah1a / 20437 MGIID:108064 Length:355 Species:Mus musculus


Alignment Length:231 Identity:65/231 - (28%)
Similarity:97/231 - (41%) Gaps:32/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PSKPEKSPATPSEEGP----PTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRIL 234
            |:...|.|  ||:..|    .|.|......|.|   ||.|...:..|||.|:|||.||..|...|
Mouse    83 PTGTSKCP--PSQRVPALTGTTASNNDLASLFE---CPVCFDYVLPPILQCQSGHLVCSNCRPKL 142

  Fly   235 LMCPLCKEPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRV 298
            ..||.|:.|..:.|:|.:|.:.....|.|.:||.||::.:|......||:.|.::|..| ..|  
Mouse   143 TCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPG-- 205

  Fly   299 WGDCRWQGREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAH 351
             ..|:|||.......||..||        :|.:|.::..:|    :|   ...:...|::.....
Mouse   206 -ASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDW---VMMQSCFGFHFMLVL 266

  Fly   352 DEMFNFYEIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
            ::.    |.:|..:..|.:......|....||||.:
Mouse   267 EKQ----EKYDGHQQFFAIVQLIGTRKQAENFAYRL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 37/153 (24%)
Siah1aXP_006530847.3 RING-HC_SIAH1 112..151 CDD:319665 18/41 (44%)
Sina 155..351 CDD:367355 37/154 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.