DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and Siah2

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_604452.1 Gene:Siah2 / 140593 RGDID:620778 Length:325 Species:Rattus norvegicus


Alignment Length:289 Identity:84/289 - (29%)
Similarity:119/289 - (41%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ATLPSPNVVTLRSPLSPPPKPPMLGRTRSTGPADGKGPASNGALSPDSSIIRQSFPEGVITPSKP 177
            :|.||.|....:.|  |||:.|     .:..||.....|:..|..|.||.:    |......|  
  Rat     6 STGPSANKPCSKQP--PPPQTP-----HAPSPAAPPAAATISAAGPGSSAV----PAAAAVIS-- 57

  Fly   178 EKSPATPSEEGPPTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLCKE 242
              .|......||  ||.:|:| |.....||.|...:..|||.|::||.||.||.:.|..||.|:.
  Rat    58 --GPGAGGGAGP--VSPQHHE-LTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRG 117

  Fly   243 PFTNS-RSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRWQ 305
            ..|.| |:|.:|.:.:...|.|.:|:.||.:.:.....|.||..|.|:|..| ..|   ..|:||
  Rat   118 ALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPG---ASCKWQ 179

  Fly   306 GREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAHDEMFNFY 358
            |.......||...|        :|.:|.::..:|    :|   ...:...|:: |....|....|
  Rat   180 GSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDW---VMMQSCFGHH-FMLVLEKQEKY 240

  Fly   359 EIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
            |.|.:   .|.:......|....||||.:
  Rat   241 EGHQQ---FFAIVLLIGTRKQAENFAYRL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 39/153 (25%)
Siah2NP_604452.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 13/43 (30%)
RING-HC_SIAH2 79..116 CDD:319666 16/36 (44%)
Sina 123..319 CDD:397316 39/154 (25%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 131..323 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.