DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and siah3

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_002941011.1 Gene:siah3 / 100497552 XenbaseID:XB-GENE-6035790 Length:241 Species:Xenopus tropicalis


Alignment Length:185 Identity:34/185 - (18%)
Similarity:61/185 - (32%) Gaps:59/185 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 CRWQGREVQWKEHLEEQHDDRLFRSSSADLEWNLGTRRKPLTGYYVFQAHDEMFNFYEIHDRQRV 366
            |:|:|.......||.:.|...:..          ||.       .||.|.|       :|....|
 Frog    86 CKWEGHLEVIVSHLTQSHTINILH----------GTE-------IVFLATD-------MHLPAPV 126

  Fly   367 --LFTMTCTSN------RRDSKY--------------------NFAYEVTVLLPDNEALSMTQKF 403
              :.|.:|..:      |:..||                    ||.|::.:   :.....:|.:.
 Frog   127 DWIITHSCLGHHFLLVLRKQEKYQGYPQFFATMMLIGTSAQAQNFNYKLEL---NRNRRKLTWES 188

  Fly   404 PVHSEYD--KDILMEGTCVSIPLTELNRFLDQDKVLHYRVSVLAVKSPRRAKPPR 456
            ...|.:|  ..::.:|.|:.:..:....|.|... |...:::.|.| |...:|.:
 Frog   189 TPRSVFDCVDSVITDGDCLILNASVAQLFSDNGS-LAIGIAIAASK-PCSVEPEK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093
Sina 248..442 CDD:281181 30/169 (18%)
siah3XP_002941011.1 Sina 105..229 CDD:239753 24/151 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.