DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and YKR070W

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_012996.1 Gene:YKR070W / 853944 SGDID:S000001778 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:371 Identity:76/371 - (20%)
Similarity:125/371 - (33%) Gaps:137/371 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCDGVVWLLVGWIPNTGAAVNALKAAGK------------------QIKFVSN------------ 62
            |.|||  |..|..|..||: :|||...:                  :.:|:|:            
Yeast    19 DIDGV--LFRGKKPIAGAS-DALKLLNRNKIPYILLTNGGGFSERARTEFISSKLDVDVSPLQII 80

  Fly    63 NSFRSEEDYMEKFRHI------GAKNVQE----DDIVHPVKTIVRYLKKHKPGERVYSLMSLEAN 117
            .|....:..:.|:..|      ..:.|.|    .|:||.. .||||.:...|    :|.:|   :
Yeast    81 QSHTPYKSLVNKYSRILAVGTPSVRGVAEGYGFQDVVHQT-DIVRYNRDIAP----FSGLS---D 137

  Fly   118 ETLRKHNIEFESLQVKE----------HLTAA-------------SLVDHLAIE---KPVGAVLF 156
            |.:.:::.:...|..|:          |..||             .:::.|..|   ||...:.|
Yeast   138 EQVMEYSRDIPDLTTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPIYF 202

  Fly   157 DIHLDLSYVELAKAIR-------------HLQENDDCQLIAGGSDVIMPLAE-------NLNVAG 201
            . :.||.:....|..|             :|:.|.:            ||.:       .|.   
Yeast   203 S-NQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGE------------PLQDYTLGKPTKLT--- 251

  Fly   202 FFDFLEHV-----KRYTQREATFLGKPSPILG-----EMFGEMFEIRDCKRCIFIGDTLVQDVQF 256
             :||..||     ||.:.:....:.:..|:||     ..|..:|         .:||....|:..
Yeast   252 -YDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVF---------MVGDNPASDIIG 306

  Fly   257 GKACGFQSLLVLSGCLTKEDMLNAPVEAQPDYYADSLAD-FTQLLE 301
            .:..|:.|.||.:|...:.|.|.   |.:|....:.:.| .|:.||
Yeast   307 AQNYGWNSCLVKTGVYNEGDDLK---ECKPTLIVNDVFDAVTKTLE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 67/337 (20%)
Hydrolase_6 25..126 CDD:290083 30/137 (22%)
Hydrolase_like 220..295 CDD:289983 17/79 (22%)
YKR070WNP_012996.1 CECR5 14..348 CDD:200106 74/368 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.