DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and PHO13

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_010045.1 Gene:PHO13 / 851362 SGDID:S000002395 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:90/310 - (29%)
Similarity:150/310 - (48%) Gaps:23/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKLSLEE-QRQFIDSFDLVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDY 71
            :|::.:| .::|:|.:|..:.|||||:||....:|.|...:|.||..|||:.||:|||.:|...|
Yeast     9 IKITNKEIAQEFLDKYDTFLFDCDGVLWLGSQALPYTLEILNLLKQLGKQLIFVTNNSTKSRLAY 73

  Fly    72 MEKFRHIGAKNVQEDDIV---HPVKTIVRYLKKHKPG-ERVYSLMSLEANETLRKHNIEFESL-- 130
            .:||...|. :|:|:.|.   :.....:|...|.:|| ::|:........|.|:.  :.:|||  
Yeast    74 TKKFASFGI-DVKEEQIFTSGYASAVYIRDFLKLQPGKDKVWVFGESGIGEELKL--MGYESLGG 135

  Fly   131 ---QVKEHLTAAS---LVDHLAIEKPVGAVLFDIHLDLSYVELAKAIRHLQENDDCQLIAGGSDV 189
               ::.....||.   ||:  .::|.|..|:..:...::|..||..:::||: |....:....|.
Yeast   136 ADSRLDTPFDAAKSPFLVN--GLDKDVSCVIAGLDTKVNYHRLAVTLQYLQK-DSVHFVGTNVDS 197

  Fly   190 IMPLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIFIGDTLVQDV 254
            ..| .:.....|....:|.:...:.|..::.|||:..:.......|.: |..:|..:||.|..|:
Yeast   198 TFP-QKGYTFPGAGSMIESLAFSSNRRPSYCGKPNQNMLNSIISAFNL-DRSKCCMVGDRLNTDM 260

  Fly   255 QFGKACGF-QSLLVLSGCLTKEDMLNAPVE-AQPDYYADSLADFTQLLEN 302
            :||...|. .:||||||..|:|..|....: .:|.:|.|.|.|...|..|
Yeast   261 KFGVEGGLGGTLLVLSGIETEERALKISHDYPRPKFYIDKLGDIYTLTNN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 73/257 (28%)
Hydrolase_6 25..126 CDD:290083 35/104 (34%)
Hydrolase_like 220..295 CDD:289983 26/76 (34%)
PHO13NP_010045.1 HAD_Pase_UmpH-like 24..308 CDD:319813 84/291 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343605
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.