DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and AT5G36790

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001119318.1 Gene:AT5G36790 / 833646 AraportID:AT5G36790 Length:362 Species:Arabidopsis thaliana


Alignment Length:312 Identity:97/312 - (31%)
Similarity:150/312 - (48%) Gaps:37/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRHILKLSLEEQRQFIDSFDLVISDCDGVVW---LLVGWIPNTGAAVNALKAAGKQIKFVSNNSF 65
            ||.:....||...|.|||.:..|.|||||:|   .|:..:|.|   ::.|:|.||::.||:|||.
plant    61 PRAMATQQLENADQLIDSVETFIFDCDGVIWKGDKLIEGVPET---LDMLRAKGKRLVFVTNNST 122

  Fly    66 RSEEDYMEKFRHIGAKNVQEDDIVHPVKTIVRYLK--KHKPGERVYSL--------MSLEANETL 120
            :|.:.|.:||..:|. ||.|::|.........||:  .....::||.:        :.|...:.|
plant   123 KSRKQYGKKFETLGL-NVNEEEIFASSFAAAAYLQSINFPKDKKVYVIGEEGILKELELAGFQYL 186

  Fly   121 -----RKHNIEFESLQVKEHLTAASLVDHLAIEKPVGAVLFDIHLDLSYVELAKAIRHLQENDDC 180
                 .|..||.:...:.||       ||     .||||:.......:|.::......::||..|
plant   187 GGPDDGKRQIELKPGFLMEH-------DH-----DVGAVVVGFDRYFNYYKIQYGTLCIRENPGC 239

  Fly   181 QLIAGGSDVIMPLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIF 245
            ..||...|.:..|.:....||....:..:...||||...:||||..:.:...:.|.|:..:.|: 
plant   240 LFIATNRDAVTHLTDAQEWAGGGSMVGALVGSTQREPLVVGKPSTFMMDYLADKFGIQKSQICM- 303

  Fly   246 IGDTLVQDVQFGKACGFQSLLVLSGCLTKEDMLNAPV-EAQPDYYADSLADF 296
            :||.|..|:.||:..|.::|||||| :|...||.:|. :.|||:|...::||
plant   304 VGDRLDTDILFGQNGGCKTLLVLSG-VTSISMLESPENKIQPDFYTSKISDF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 77/262 (29%)
Hydrolase_6 25..126 CDD:290083 35/118 (30%)
Hydrolase_like 220..295 CDD:289983 28/75 (37%)
AT5G36790NP_001119318.1 PLN02645 56..362 CDD:178251 97/312 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4144
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.