DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and AT5G10460

DIOPT Version :10

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_196608.2 Gene:AT5G10460 / 830910 AraportID:AT5G10460 Length:306 Species:Arabidopsis thaliana


Alignment Length:139 Identity:30/139 - (21%)
Similarity:52/139 - (37%) Gaps:43/139 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLILKNCNYYEEATKFAEKWMKRCNFEIAVLKVEMSQYPMASSIIKFLPCCKDLRIAADDLDAFR 72
            ||:||:..:....||      :.|....:.:.:::.|. :|:|:                     
plant   541 SLLLKHIGFVYHPTK------ETCLSGQSCMDIKVEQV-LANSL--------------------- 577

  Fly    73 WWLQKVPEQLDSLQLLTHEQERNTLTLPGDFVGLPQIMTVPSLYFWCRAAFSDEQF------LEL 131
              ||....:::..|..|:....|.|.|..|  ||.|.||..     .|...:|::|      .||
plant   578 --LQSNLGRMNLYQDSTNLDRINLLILGKD--GLAQEMTNE-----IRTQSTDDEFALDGKIYEL 633

  Fly   132 KAKSMSFNA 140
            ..|::..|:
plant   634 DLKTVDANS 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD_Pase_UmpH-like 24..295 CDD:319811 24/123 (20%)
AT5G10460NP_196608.2 HAD_like 24..302 CDD:319827
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.