DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and PDXP

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_064711.1 Gene:PDXP / 57026 HGNCID:30259 Length:296 Species:Homo sapiens


Alignment Length:304 Identity:92/304 - (30%)
Similarity:133/304 - (43%) Gaps:55/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKNVQEDDIV 89
            |:.|||||:|.....:|.....:..|..|||...||||||.|:..:...:|..:|...::.:.:.
Human    22 VLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELALRFARLGFGGLRAEQLF 86

  Fly    90 HPVKTIVRYLKKHKPGE-----RVYSLMSLEANETLRKHNIEFESLQVKEHLTAASLVDHLAIEK 149
            .......|.|::..||.     .|:.|    ..|.||            ..|.||.|  .||.:.
Human    87 SSALCAARLLRQRLPGPPDAPGAVFVL----GGEGLR------------AELRAAGL--RLAGDP 133

  Fly   150 PVG--------AVL--FDIHLDLSYVELAKAIRHLQENDDCQLIAGGSDVIMPLAENLNVAGFFD 204
            ..|        |||  :|.|  .|:.:|.:|..||:: .:|.|:|...|...||::.....|...
Human   134 SAGDGAAPRVRAVLVGYDEH--FSFAKLREACAHLRD-PECLLVATDRDPWHPLSDGSRTPGTGS 195

  Fly   205 FLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIFIGDTLVQDVQFGKACGFQSLLVLS 269
            ....|:..:.|:|..:|||||.:.|...|.|.| |..|.:.:||.|..|:.||..||..::|.|:
Human   196 LAAAVETASGRQALVVGKPSPYMFECITENFSI-DPARTLMVGDRLETDILFGHRCGMTTVLTLT 259

  Fly   270 GCLTKEDMLNAPVEAQ-----------PDYYADSLADFTQLLEN 302
            |....|       |||           |.||.:|:||.|:.||:
Human   260 GVSRLE-------EAQAYLAAGQHDLVPHYYVESIADLTEGLED 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 78/259 (30%)
Hydrolase_6 25..126 CDD:290083 30/105 (29%)
Hydrolase_like 220..295 CDD:289983 30/85 (35%)
PDXPNP_064711.1 PGP_euk 18..290 CDD:273635 88/296 (30%)
Substrate binding. /evidence=ECO:0000269|PubMed:18058037, ECO:0007744|PDB:2P27 58..60 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.