DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and zgc:77375

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_991194.1 Gene:zgc:77375 / 402927 ZFINID:ZDB-GENE-040426-1827 Length:429 Species:Danio rerio


Alignment Length:272 Identity:60/272 - (22%)
Similarity:101/272 - (37%) Gaps:73/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCDGVVWLLVGWIPNTGAAVNALKA------AGKQIK----FVSNNSFRSEEDYMEKF------- 75
            |..|...:.|.::.|.|..:...||      .|..|.    .:|::..|..:.|.:||       
Zfish    61 DTKGQFLVPVVFVTNAGNCLRQKKADQLSHILGVPISQDQVMMSHSPLRMFKKYHDKFVLVSGQG 125

  Fly    76 ------RHIGAKNVQEDDIVH---PVKTIVRYLKKHK-PGERVYSLMSLEA----NETLR-KHNI 125
                  :::|..||...|::.   |:..:|.:.::.| |...|.:|..:||    .|.:| :.|:
Zfish   126 PVLDIAKNVGFTNVVSIDMLRESFPLLDMVDHNRRPKLPSSPVANLPRVEAVVLFGEPIRWETNL 190

  Fly   126 EFESLQVKEHLTAASLVDHLAIEKPVGAVLFDIHLDLSYVELAKAIRHLQENDDCQLIAGGSDVI 190
            :   |.|...||..:|.............|...::||.::..|.:.|.            |....
Zfish   191 Q---LIVDVLLTNGNLSSAYETAHSTHLPLLACNMDLMWMAEAHSPRF------------GHGTF 240

  Fly   191 MPLAENLNVAGFFDFLEHVKRYTQREATF---LGKPSPILGEMFGEMFEIRD----------CKR 242
            |...|::           .|:.|.:|..:   :||||. |...|.| |.||:          .:.
Zfish   241 MVCLESI-----------YKKITGKELKYEALMGKPSE-LTYHFAE-FLIREQAVERGWRAPIRS 292

  Fly   243 CIFIGDTLVQDV 254
            ...|||.|:.|:
Zfish   293 LYAIGDNLMTDI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 60/272 (22%)
Hydrolase_6 25..126 CDD:290083 29/129 (22%)
Hydrolase_like 220..295 CDD:289983 15/45 (33%)
zgc:77375NP_991194.1 Hydrolase_6 34..137 CDD:290083 15/75 (20%)
HAD-SF-IIA 35..310 CDD:273637 60/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.