DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and CG5567

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649015.2 Gene:CG5567 / 39986 FlyBaseID:FBgn0036760 Length:330 Species:Drosophila melanogaster


Alignment Length:310 Identity:92/310 - (29%)
Similarity:155/310 - (50%) Gaps:21/310 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HILKLSLEEQRQFIDSFDLVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEED 70
            ::|:||..:..:::..||.||:|||||:|:....:..:...:|.||..||.|.|.:|||.::..:
  Fly    23 NLLELSSAKVTEWLAGFDSVITDCDGVLWIYGQALEGSVDVMNQLKGMGKSIYFCTNNSTKTRSE 87

  Fly    71 YMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHKPGERVYSLMSLEANETLRKHNIEFESL---QV 132
            .::|...:|. :::|:.|:........|||:....:||:.:.|....:.|....|:...:   .:
  Fly    88 LLKKGVELGF-HIKENGIISTAHATAAYLKRRNFSKRVFVIGSEGITKELDAVGIQHTEVGPEPM 151

  Fly   133 KEHLTAASLVDHLAIEKPVGAVL--FDIHLDLSYVELAKAIRHLQEND-DCQLIAGGSDVIMPLA 194
            |..| |..:..||.::..:|||:  ||.|  .|:.::.||..:|  || :|..:|..:|...|: 
  Fly   152 KGSL-AEFMAQHLKLDTDIGAVVVGFDEH--FSFPKMMKAASYL--NDPECLFVATNTDERFPM- 210

  Fly   195 ENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIFIGDTLVQDVQFGKA 259
            .|:.|.|...|:..::...:|:...:|||:|.:.|......:| |..|.:.|||....|:..|..
  Fly   211 PNMIVPGSGSFVRAIQTCAERDPVVIGKPNPAICESLVTEKKI-DPSRTLMIGDRANTDILLGFN 274

  Fly   260 CGFQSLLVLSGCLTKED-----MLNAPVEAQ--PDYYADSLADFTQLLEN 302
            ||||:|||.||....:|     :...|.|.:  ||.|...|.|....:.|
  Fly   275 CGFQTLLVGSGIHQLKDVERWKLSQDPEEKKLIPDVYLPKLGDLLPSIVN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 76/250 (30%)
Hydrolase_6 25..126 CDD:290083 29/100 (29%)
Hydrolase_like 220..295 CDD:289983 29/81 (36%)
CG5567NP_649015.2 PGP_euk 40..318 CDD:273635 86/285 (30%)
Hydrolase_6 42..142 CDD:290083 29/100 (29%)
Hydrolase_like 235..318 CDD:289983 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.