DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and Hdhd2

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001014173.2 Gene:Hdhd2 / 361351 RGDID:1308579 Length:384 Species:Rattus norvegicus


Alignment Length:271 Identity:63/271 - (23%)
Similarity:101/271 - (37%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NTGAAVNA---------------LKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKNVQEDDIVHP 91
            |||..|..               |:||...::||:|.:..|:.|.:|:.|.:      |.||.. 
  Rat   137 NTGGRVTVPLLRSGVTLRSHLLLLRAASVMVRFVTNTTKESKRDLLERLRKL------EFDISE- 194

  Fly    92 VKTIVRYLKKHKPGERVYSLMSLEANETLRKHNIEFESLQVKEHLTAASLVDHLAIEKPVGAVLF 156
                          |.:::  ||.|...|      .|..||:..|    |||..|:....|....
  Rat   195 --------------EEIFT--SLTAARNL------IEQRQVRPML----LVDDRALPDFTGVQTH 233

  Fly   157 DIHLDLSYVELAKAIRHLQ-ENDDCQLIAGGSDVIMPLAENLNVAGFF-----------DFLEHV 209
            |.:..:  :.||....|.| .|:..:|:..|:.:|.     ::.|.::           .|:..:
  Rat   234 DPNAVV--IGLAPEHFHYQLLNEAFRLLLDGAPLIA-----IHKARYYKRKDGLALGPGPFVTAL 291

  Fly   210 KRYTQREATFLGKPSPILGEMFGEMFEIRDC--KRCIFIGDTLVQDVQFGKACGFQSLLVLSG-- 270
            :..|..:|..:|||..   ..|.|.....||  :..:.|||....||...:..|...:||.:|  
  Rat   292 EYATDTKAVVVGKPEK---TFFLEALRDTDCAPEEAVMIGDDCRDDVDGAQNIGMLGILVKTGKY 353

  Fly   271 CLTKEDMLNAP 281
            ....|:.:|.|
  Rat   354 KAADEEKINPP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 59/256 (23%)
Hydrolase_6 25..126 CDD:290083 22/98 (22%)
Hydrolase_like 220..295 CDD:289983 19/66 (29%)
Hdhd2NP_001014173.2 Yos1 5..>64 CDD:285740
HAD-SF-IIA-hyp3 122..382 CDD:162372 63/271 (23%)
HAD_like <159..>211 CDD:304363 19/80 (24%)
Hydrolase_like 301..375 CDD:289983 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.