DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and CG17294

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster


Alignment Length:257 Identity:64/257 - (24%)
Similarity:112/257 - (43%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHKPG 105
            ||...|:..|:.:|..:|||:|.:..|:....|:...||.: :...:|...:...|.|::    .
  Fly    22 PNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQ-LDASEIYSSLSAAVSYVE----N 81

  Fly   106 ERV--YSLMSLEANETLRKHNIEFESLQVKEHLTAASLVDHLAIEKPVGAVLFDIHLDLSYVELA 168
            ||:  |.::|.:|.:       :|.....:.:  ..|:|..||.:.            .:|.:|.
  Fly    82 ERLNPYYILSEDARQ-------DFPPEDTRRY--KDSVVIGLAPKA------------FNYEQLN 125

  Fly   169 KAIRHLQENDDCQLIAGGSDVIMPLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPIL--GEMF 231
            :|...|.||.:.:|||.........||.| ..|...|::.::..|.|.|..:|||:|..  |.:.
  Fly   126 EAFNVLLENKNHKLIAVHQGKYYKRAEGL-ALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGALA 189

  Fly   232 GEMFEIRDCKRCIFIGDTLVQDVQFGKACGFQSLLVLSGCLTKEDMLNAPVEAQPDYYADSL 293
            |     ||...|:.|||....|:....:.|.|.:||.:|....:...:.|..|..:.:|:::
  Fly   190 G-----RDPASCVMIGDDANDDIVGAMSMGMQGILVKTGKYLPDVKPSPPPTALLENFAEAV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 60/232 (26%)
Hydrolase_6 25..126 CDD:290083 21/86 (24%)
Hydrolase_like 220..295 CDD:289983 21/76 (28%)
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 64/257 (25%)
Hydrolase_6 7..98 CDD:290083 21/87 (24%)
DUF843 <84..136 CDD:114536 14/72 (19%)
Hydrolase_like 175..245 CDD:289983 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453836
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.