DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and CG10352

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster


Alignment Length:300 Identity:105/300 - (35%)
Similarity:158/300 - (52%) Gaps:12/300 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPPRHILKLSLEEQRQFIDSFDLVISDCDGVVWL-LVGWIPNTGAAVNALKAAGKQIKFVSNNS 64
            ||..:::..::.:|:.:|.||||||..|||||||. |..:||.:..|:..|...||.:.||:|||
  Fly     1 MSSVKYLKNMTEKERDEFFDSFDLVFCDCDGVVWYPLRDFIPGSAEALAHLAHLGKDVTFVTNNS 65

  Fly    65 FRSEEDYMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHKPGERVYSLMSLEANETLRKHNIEFES 129
            ..|.::::|||...|...:.|..||||.:||..:|:..|....:|.|.:....|.|  .|..|..
  Fly    66 ISSVKEHIEKFEKQGHLKIDEHQIVHPAQTICDHLRSIKFEGLIYCLATSPFKEIL--VNAGFRL 128

  Fly   130 LQVKEHLTAASLVD-HLAI--EKPVGAVLFDIHLDLSYVELAKAIRHLQ-ENDDCQLIAGGSDVI 190
            .|.........|.| |.||  .:.|.||:.|:..:||..:|.:|  |.| :|..|..:||.:|.:
  Fly   129 AQENGSGIITRLKDLHEAIFSGESVDAVIIDVDFNLSAAKLMRA--HFQLQNPKCLFLAGAADAL 191

  Fly   191 MPLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIFIGDTLVQDVQ 255
            :|..:. .:.|...|::.|.:...|:...||||...|.::..|........|.:|:||:|..|:.
  Fly   192 IPFGKG-EIIGPGAFIDVVTQAVGRQPITLGKPGEDLRKLLLERHREIPPSRVLFVGDSLASDIG 255

  Fly   256 FGKACGFQSLLVLSGCLTKEDMLNAPVE--AQPDYYADSL 293
            |.:|.|:|:||||:|....||:...|::  ..|||.||.|
  Fly   256 FARASGYQTLLVLTGGTKLEDVQRLPIDHSQMPDYLADCL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 86/249 (35%)
Hydrolase_6 25..126 CDD:290083 39/101 (39%)
Hydrolase_like 220..295 CDD:289983 29/75 (39%)
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 97/277 (35%)
Hydrolase_6 25..127 CDD:290083 39/103 (38%)
Hydrolase_like 220..293 CDD:289983 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453844
Domainoid 1 1.000 54 1.000 Domainoid score I4144
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26206
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 1 1.000 - - FOG0014304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.