DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and PGP

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001035830.1 Gene:PGP / 283871 HGNCID:8909 Length:321 Species:Homo sapiens


Alignment Length:327 Identity:95/327 - (29%)
Similarity:152/327 - (46%) Gaps:53/327 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKLSLEEQRQFIDSFDLVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYM 72
            ::||.|..:..:...|.::.|||||:|.....:|....|:.||:|.||::.|::|||.::...|.
Human    14 VRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRAAYA 78

  Fly    73 EKFRHIG----AKNVQEDDIVHPVKTIVRYLKKH---KPGERVYSLMS--LEANETLRKHNIEFE 128
            ||.|.:|    |......::.........||::.   .|..:.|.|.|  |.|         |.|
Human    79 EKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAA---------ELE 134

  Fly   129 SLQV------KEHLTAASLVD--HLAIEKPVGAVL--FDIHLDLSYVELAKAIRHLQENDDCQLI 183
            ::.|      .|.|......|  |..:|..|.||:  ||.|  .||::|.||:|:||: ..|.|:
Human   135 AVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPH--FSYMKLTKALRYLQQ-PGCLLV 196

  Fly   184 AGGSDVIMPLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIFIGD 248
            ....|..:||.....:||....:..|:...||:|..:||||..:.:...:.:.|.. :|.:.:||
Human   197 GTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINP-ERTVMVGD 260

  Fly   249 TLVQDVQFGKACGFQSLLVLSG--------------CLTKEDMLNAPVEAQPDYYADSLADFTQL 299
            .|..|:..|..||.:::|.|:|              |::|:.|:       ||:|.||:||....
Human   261 RLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMV-------PDFYVDSIADLLPA 318

  Fly   300 LE 301
            |:
Human   319 LQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 79/263 (30%)
Hydrolase_6 25..126 CDD:290083 31/109 (28%)
Hydrolase_like 220..295 CDD:289983 24/88 (27%)
PGPNP_001035830.1 PGP_euk 28..315 CDD:273635 90/306 (29%)
Hydrolase_6 31..138 CDD:290083 33/115 (29%)
Hydrolase_like 232..315 CDD:289983 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149844
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.