DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and HDHD5

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_149061.1 Gene:HDHD5 / 27440 HGNCID:1843 Length:423 Species:Homo sapiens


Alignment Length:283 Identity:63/283 - (22%)
Similarity:105/283 - (37%) Gaps:71/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCDGVVWLLVGW--IPNTGAAVNALKAAGKQIK----FVSNNSFRSEEDYMEKFRHIGAKNVQED 86
            |.|||  |:.|.  ||....|...|..:..|::    ||:|.....:....::...:....|..|
Human    52 DIDGV--LVRGHRVIPAALKAFRRLVNSQGQLRVPVVFVTNAGNILQHSKAQELSALLGCEVDAD 114

  Fly    87 DIV---HPVKTIVRYLKKHKPGERVYSLMS-----LEANETLRKHNIEFESLQVKEHLTAASLVD 143
            .::   .|:|....|.:|.       .|:|     :|..:.|...|:    :.|.|...|..|:|
Human   115 QVILSHSPMKLFSEYHEKR-------MLVSGQGPVMENAQGLGFRNV----VTVDELRMAFPLLD 168

  Fly   144 HLAIEKPVGAVLFDIHLDLSYVE----LAKAIR---HLQENDDCQLIAG--GSDVIMP------- 192
            .:.:|:.:.......: |...:|    |.:.:|   .||...|..|..|  |:.:..|       
Human   169 MVDLERRLKTTPLPRN-DFPRIEGVLLLGEPVRWETSLQLIMDVLLSNGSPGAGLATPPYPHLPV 232

  Fly   193 LAENLNV-------------AGFFDFLEHV-KRYTQREATF---LGKPSPILGEMFGEMFEIRDC 240
            ||.|:::             ..|...||.: ::.|.:|..:   :|||| ||...:.|....|..
Human   233 LASNMDLLWMAEAKMPRFGHGTFLLCLETIYQKVTGKELRYEGLMGKPS-ILTYQYAEDLIRRQA 296

  Fly   241 KR---------CIFIGDTLVQDV 254
            :|         ...:||..:.||
Human   297 ERRGWAAPIRKLYAVGDNPMSDV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 63/283 (22%)
Hydrolase_6 25..126 CDD:290083 25/111 (23%)
Hydrolase_like 220..295 CDD:289983 13/44 (30%)
HDHD5NP_149061.1 CECR5 47..360 CDD:200106 63/283 (22%)
Hydrolase_6 49..152 CDD:290083 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.