DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2680 and pgp

DIOPT Version :9

Sequence 1:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001363850.1 Gene:pgp / 100488448 XenbaseID:XB-GENE-999283 Length:306 Species:Xenopus tropicalis


Alignment Length:315 Identity:93/315 - (29%)
Similarity:150/315 - (47%) Gaps:44/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KLSLEEQRQFIDSFDLVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYME 73
            :|:.|..|:|:.|.|.|:.|||||:|.....||.....:|.||.|.|::.|::|||.::...|.|
 Frog     8 RLNGELSRRFLASVDTVLFDCDGVLWRGDEAIPGAPDLINGLKRANKRVFFLTNNSTKTRSMYAE 72

  Fly    74 KFRHIGAKNVQEDDIVHPVKTIVRYLK-----KHKPGERVYSLMSLEANETLRKHNIEFESLQV- 132
            |...:|.| .:.:::.........||:     |.|    ||.:.....:|       ||.:..: 
 Frog    73 KLGRLGFK-AEPEEVFGTAYCTAIYLRDIARLKGK----VYLIGGRALSE-------EFGAAGIP 125

  Fly   133 -----KEHLTAASLVDHLAI--EKPVGAVL--FDIHLDLSYVELAKAIRHLQENDDCQLIAGGSD 188
                 .:|:|... .|..::  :..|.||:  ||.|  .||::|.:|:::||: ..|..||..:|
 Frog   126 HLGCGADHVTGTQ-KDWASVQGDSDVKAVVVGFDEH--FSYMKLNRALQYLQD-PSCLFIATNTD 186

  Fly   189 VIMPLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDC----KRCIFIGDT 249
            ..:||.....:.|....:..|:....|:|..:||||..|.:..     ::||    .|.:.:||.
 Frog   187 TRLPLEGGRAIPGTGCLVRAVETAAHRKAQVIGKPSSFLYDCV-----VKDCGLDPARTVMVGDR 246

  Fly   250 LVQDVQFGKACGFQSLLVLSGCLTKEDML----NAPVEAQPDYYADSLADFTQLL 300
            |..|:|.|..||.::||.|:|..:.||..    :..:...||||.:|:||....|
 Frog   247 LDTDIQMGSTCGIRTLLTLTGFSSLEDAKSYQDSGALSMVPDYYVNSVADLLPAL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 76/263 (29%)
Hydrolase_6 25..126 CDD:290083 30/105 (29%)
Hydrolase_like 220..295 CDD:289983 27/82 (33%)
pgpNP_001363850.1 HAD_like 21..301 CDD:389748 87/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.