DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bbeta and EIF2B4

DIOPT Version :9

Sequence 1:NP_570020.1 Gene:eIF2Bbeta / 31256 FlyBaseID:FBgn0024996 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001305894.1 Gene:EIF2B4 / 8890 HGNCID:3260 Length:544 Species:Homo sapiens


Alignment Length:351 Identity:80/351 - (22%)
Similarity:148/351 - (42%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TQLIHAIKV--------GLVEGSYNITNKTLDIFKYIIMSKSWQNADALMQIVRDQCKILQAALP 66
            :.:||...|        |||.||   ..:.:.:.:            ||.|:::|     ....|
Human   221 SSVIHPAMVRLGLQYSQGLVSGS---NARCIALLR------------ALQQVIQD-----YTTPP 265

  Fly    67 QETVTSNIARRILKLTREEFDLLHAKVQHFADDSQASLSLHKLVTQTSESNVSVDYSVPQH---- 127
            .|           :|:|:..:.|...:.........|.|:|..:...::...||..|..:.    
Human   266 NE-----------ELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKS 319

  Fly   128 GLREALLDHLQEVETELETSSENICVQAEEHIHSSEIILTLGHSRSVENFLKRAIKKRQFLTIIV 192
            .||.|:..::||   ::..:::.|...|.:.|.:.::||..|.|..|...|:.|..:.:...::|
Human   320 ELRAAIDRYVQE---KIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV 381

  Fly   193 AECAPACRGHNLAASLANE-KNVEIVVIPDAAIFAMMSRVNKVIIGTHSVLANGGLRAACGAYTV 256
            .:..|...|.:...||.:. .....::||.|:.  ::..|:||::|.|::||||.:.:..|...:
Human   382 VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASY--VLPEVSKVLLGAHALLANGSVMSRVGTAQL 444

  Fly   257 ALAAKHYSVPVIVLAPMYKLSPLHLCEQ---DAFNMVGCAEDVIPYDSIPAREA----------- 307
            ||.|:.::|||:|....||     .||:   |||    .:.::...|.:..:..           
Human   445 ALVARAHNVPVLVCCETYK-----FCERVQTDAF----VSNELDDPDDLQCKRGEHVALANWQNH 500

  Fly   308 ---KVYSPMFDYVPPELVTLFISNTG 330
               ::.:.::|..|||||.|.|:..|
Human   501 ASLRLLNLVYDVTPPELVDLVITELG 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BbetaNP_570020.1 GCD2 8..345 CDD:275543 80/351 (23%)
IF-2B 21..334 CDD:279362 75/332 (23%)
EIF2B4NP_001305894.1 GCD2 240..538 CDD:224105 75/332 (23%)
IF-2B 240..530 CDD:279362 75/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.