DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bbeta and GCD2

DIOPT Version :9

Sequence 1:NP_570020.1 Gene:eIF2Bbeta / 31256 FlyBaseID:FBgn0024996 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_011597.1 Gene:GCD2 / 852974 SGDID:S000003315 Length:651 Species:Saccharomyces cerevisiae


Alignment Length:389 Identity:82/389 - (21%)
Similarity:138/389 - (35%) Gaps:116/389 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDIFKYIIMSKSWQNADA------LMQIVRDQCKILQAALPQETVTSNIARRILKLTREEFDLLH 90
            |::|:.:|  |.:|....      |...:..|..:|:.|.|......|..|.:    ::|..|  
Yeast   297 LEVFQIVI--KDYQTPKGTTLSRNLTSYLSHQIDLLKKARPLSVTMGNAIRWL----KQEISL-- 353

  Fly    91 AKVQHFADDSQASLSLHKLVTQTSESNVSVDYSVPQHGLREALLDHL-QEVETELETSSENICVQ 154
                                         :|.|.|....::.|.:.: |..:.::|.:.:.|...
Yeast   354 -----------------------------IDPSTPDKAAKKDLCEKIGQFAKEKIELADQLIIDN 389

  Fly   155 AEEHIHSSEIILTLGHSRSV-ENFLKRAIKKRQFLTIIVAECAPACRGHNLAASLANE-KNVEIV 217
            |...|..|..|:|.|.|:.: |..|..||..::.:.:||.:..|...|..:|.:|.|. .||...
Yeast   390 ASTQIEESTTIVTYGSSKVLTELLLHNAISLKKNIKVIVVDSRPLFEGRKMAETLRNAGVNVMYA 454

  Fly   218 VIPDA-AIFAMMSRVNKVIIGTHSVLANGGLRAACGAYTVALAAKHYSVPVIVLAPMYKLSPLHL 281
            :|... .||.|  .|:.|.:|.||:|:||.|.:..|...:|::||..::||:|.....|.|....
Yeast   455 LITSLDTIFNM--DVDYVFLGAHSILSNGFLYSRAGTAMLAMSAKRRNIPVLVCCESLKFSQRVQ 517

  Fly   282 CEQDAFNMVGCAEDV--IPYDSIPAR--------------------------------------- 305
            .:...||.:....|:  |.|::...|                                       
Yeast   518 LDSVTFNELADPNDLVNIDYENPVERRGNKGALLNQFIKERKFEKKKLAMENKPKGNKIGGKKGS 582

  Fly   306 --EAK------------------------VYSPMFDYVPPELVTLFISNTGGHAPSYVYRLLTE 343
              |:|                        :.:.::|..|||.:...|:..|...||.|..:|.|
Yeast   583 EGESKDASNEEDSNSKNILDGWQELPSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILRE 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BbetaNP_570020.1 GCD2 8..345 CDD:275543 82/389 (21%)
IF-2B 21..334 CDD:279362 77/378 (20%)
GCD2NP_011597.1 PHA03255 120..>232 CDD:165513
IF-2B 285..637 CDD:395798 77/378 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.