DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bbeta and eif2b4

DIOPT Version :9

Sequence 1:NP_570020.1 Gene:eIF2Bbeta / 31256 FlyBaseID:FBgn0024996 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005160517.1 Gene:eif2b4 / 541548 ZFINID:ZDB-GENE-030131-955 Length:555 Species:Danio rerio


Alignment Length:366 Identity:87/366 - (23%)
Similarity:145/366 - (39%) Gaps:86/366 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KEQPLKEIT---QLIHAIKV--------GLVEGSYNITNKTLDIFKYIIMSKSW-QNADALMQIV 54
            |..|.::|:   .:||...|        |::.||...:...|..||.:|...|. .|.:....:|
Zfish   221 KNPPTQQISIPATVIHPSIVRLGLQYSQGIIAGSNARSVALLHAFKQVIQDYSTPPNEELSRDLV 285

  Fly    55 R---------DQCKILQAALPQETVTSNIARRILKLTREEFDLLHAKVQHFADDSQASLSLHKLV 110
            .         .||:.|.|::      .|..:.|.|                        .:..:.
Zfish   286 NKLSPYISFLSQCRPLSASM------GNAIKYIKK------------------------EISNIP 320

  Fly   111 TQTSESNVSVDYSVPQHGLREALLDHLQEVETELETSSENICVQAEEHIHSSEIILTLGHSRSVE 175
            .|..|....        |..:|.:|  ..:..::..:||.|...|.|.|.:.::||..|.|..|.
Zfish   321 NQCKEEEAK--------GKLQACID--SYINEKIILASEAISKYAIEKISNGDVILVYGCSSLVN 375

  Fly   176 NFLKRAIKKRQFLTIIVAECAPACRGHNLAASLANEKNVEIVVIPDAAIFAMMSRVNKVIIGTHS 240
            :.|..|.:|::...:||.:..|...|......|. :|.:....:..:|:..::..|:||.:|.|:
Zfish   376 HILCEAFEKQRQFRVIVVDSRPRLEGREALRRLV-KKGIRCTYVLISALSYILPEVSKVFLGAHA 439

  Fly   241 VLANGGLRAACGAYTVALAAKHYSVPVIVLAPMYKLSPLHLCEQ---DAFNMVGCAEDVIPYDSI 302
            :||||.:.:..|...:||.||.|:|||:|....||     .||:   |:| :....:|  |.|.|
Zfish   440 LLANGYVMSRVGTSQIALVAKAYNVPVLVCCETYK-----FCERVQTDSF-VSNELDD--PDDLI 496

  Fly   303 PAREAKVY-------------SPMFDYVPPELVTLFISNTG 330
            ..|..|.:             :.::|..||:.|.|.|::.|
Zfish   497 VTRNGKTHLENWQTVKSLGLLNLVYDVTPPDFVDLVITDLG 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BbetaNP_570020.1 GCD2 8..345 CDD:275543 85/360 (24%)
IF-2B 21..334 CDD:279362 80/336 (24%)
eif2b4XP_005160517.1 GCD2 235..549 CDD:224105 84/352 (24%)
IF-2B 251..541 CDD:279362 80/336 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.