DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bbeta and Eif2b4

DIOPT Version :9

Sequence 1:NP_570020.1 Gene:eIF2Bbeta / 31256 FlyBaseID:FBgn0024996 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038967625.1 Gene:Eif2b4 / 117019 RGDID:620208 Length:544 Species:Rattus norvegicus


Alignment Length:361 Identity:86/361 - (23%)
Similarity:148/361 - (40%) Gaps:95/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TQLIHAIKV--------GLVEGSYNITNKTLDIFKYIIMSKSWQNA------DALMQIVRDQCKI 60
            :.:||...|        |||.||                     ||      .||.|:::|    
  Rat   221 SSVIHPAMVRLGLQYSQGLVSGS---------------------NARCIALLHALQQVIQD---- 260

  Fly    61 LQAALPQETVTSNIARRILKLTREEFDLLHAKVQHFADDSQASLSL-------HKLVTQTSESNV 118
             ....|.|           :|:|:..:.|...:.........|.|:       :|.||..|.|..
  Rat   261 -YTTPPNE-----------ELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFFNKEVTGMSSSKR 313

  Fly   119 SVDYSVPQHGLREALLDHLQEVETELETSSENICVQAEEHIHSSEIILTLGHSRSVENFLKRA-I 182
            ..:   .:..|:||:..::||   ::..:|:.|...|.:.|...::||..|.|..|...|:.| :
  Rat   314 EEE---AKSELKEAIDRYVQE---KIVLASQAISRFASKKISDGDVILVYGCSSLVSRILQEAWV 372

  Fly   183 KKRQFLTIIVAECAPACRG-HNLAASLANEKNVEIVVIPDAAIFAMMSRVNKVIIGTHSVLANGG 246
            :.|:| .::|.:..|...| |.|...:........::||.|:.  ::..|:||::|.|::||||.
  Rat   373 EGRRF-RVVVVDSRPRLEGRHMLHCLVRAGVPTSYLLIPAASY--VLPEVSKVLLGAHALLANGS 434

  Fly   247 LRAACGAYTVALAAKHYSVPVIVLAPMYKLSPLHLCEQ---DAFNMVGCAEDVIPYDSIPAREA- 307
            :.:..|...:||.|:.::|||:|....||     .||:   |||    .:.::...|.:..:.. 
  Rat   435 VMSRVGTAQLALVARAHNVPVLVCCETYK-----FCERVQTDAF----VSNELDDPDDLQCKRGD 490

  Fly   308 -------------KVYSPMFDYVPPELVTLFISNTG 330
                         ::.:.::|..|||||.|.|:..|
  Rat   491 QVTLANWQNNSSLRLLNLVYDVTPPELVDLVITELG 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BbetaNP_570020.1 GCD2 8..345 CDD:275543 86/361 (24%)
IF-2B 21..334 CDD:279362 81/342 (24%)
Eif2b4XP_038967625.1 IF-2B 240..530 CDD:395798 81/342 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.