DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and ytfF

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_418631.2 Gene:ytfF / 948732 ECOCYCID:G7867 Length:321 Species:Escherichia coli


Alignment Length:251 Identity:53/251 - (21%)
Similarity:80/251 - (31%) Gaps:84/251 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYISLLTLTLQNAILG-LSMRYARTRPGDIFLSSTAVLMAEFAKLI--TCLFLVFNEEGKDAQKF 84
            :|::|..:.|..|.|| :.:|....|..     .||:::.....||  .||.......|......
E. coli    37 RYLALGLIALPIAWLGRVRLRQLARRDW-----LTALMLTMMGNLIYYFCLASAIQRTGAPVSTM 96

  Fly    85 VRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRR 149
            :           :.||.|.:|     |..||||   |..|.                        
E. coli    97 I-----------IGTLPVVIP-----VFANLLY---SQRDG------------------------ 118

  Fly   150 KLLNTQWG----ALLLLVMGIVLVQLAQTEGP---------TSGSAGGAA--------AAATAAS 193
            ||   .||    ||:.:.:|:..|.:|:....         |||......        |...|..
E. coli   119 KL---AWGKLAPALICIGIGLACVNIAELNHGLPDFDWARYTSGIVLALVSVVCWAWYALRNARW 180

  Fly   194 SGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFG 249
            ....|:::.|  :||...|.       :.....|.|..::.:..|.|....|:|||
E. coli   181 LRENPDKHPM--MWATAQAL-------VTLPVSLIGYLVACYWLNTQTPDFSLPFG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 53/251 (21%)
EamA 101..341 CDD:304911 36/170 (21%)
ytfFNP_418631.2 RhaT 1..309 CDD:223769 53/251 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.