DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and yijE

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_418378.4 Gene:yijE / 948445 ECOCYCID:EG11902 Length:301 Species:Escherichia coli


Alignment Length:317 Identity:69/317 - (21%)
Similarity:112/317 - (35%) Gaps:77/317 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANTLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQK 83
            :|.|....|:.|||   |...|..:.:.....|.......|...|..|:..:.|:....|.....
E. coli     7 SNPLAISGLVVLTL---IWSYSWIFMKQVTSYIGAFDFTALRCIFGALVLFIVLLLRGRGMRPTP 68

  Fly    84 FVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILR 148
            |..:|       .:..|:.|  .:|.:.|..|:...|..:...:|.:.:.:.|     ||.:.|.
E. coli    69 FKYTL-------AIALLQTC--GMVGLAQWALVSGGAGKVAILSYTMPFWVVI-----FAALFLG 119

  Fly   149 RKLLNTQWGALLLLVMGIVLV----QLAQTEGPT------SGSAGGAAAAATAASSGGAPEQNRM 203
            .:|...|:.|:|:...|:.||    ||..:...:      ||.:.||:|..........|..:.:
E. coli   120 ERLRRGQYFAILIAAFGLFLVLQPWQLDFSSMKSAMLAILSGVSWGASAIVAKRLYARHPRVDLL 184

  Fly   204 -LGLWAALGACFLSG-----------------FAGIYFEKILKGA-EISVW---MRNV-----QL 241
             |..|..|.|..:..                 |..:.:..||..| ..|:|   ::|:     .|
E. coli   185 SLTSWQMLYAALVMSVVALLVPQREIDWQPTVFWALAYSAILATALAWSLWLFVLKNLPASIASL 249

  Fly   242 SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAG---GGLIVAVVVKYA 295
            |.|::|    .|.|                ||.|:|:....|   |..||.:|:..|
E. coli   250 STLAVP----VCGV----------------LFSWWLLGENPGAVEGSGIVLIVLALA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 69/317 (22%)
EamA 101..341 CDD:304911 52/235 (22%)
yijENP_418378.4 RhaT 6..293 CDD:223769 69/317 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.